PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00012118-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family GRAS
Protein Properties Length: 537aa    MW: 59618.7 Da    PI: 4.8549
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00012118-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS257.64.5e-791485302374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL  cA a+++++  ++q+l++ l++las +gd+++Rlaa+ ++A  a++++       +lp+s+  + + +   +al  f+evsP++++ 
  PSME_00012118-RA 148 EQLLNPCAIAIANNNIVRIQHLIWVLHDLASVSGDANHRLAAHGLRAFTAKIMH----AGGTLPCSDFISADPKLFHKALLKFHEVSPWYQLL 236
                       689**************************************************9....778899999998887777788888*********** PP

              GRAS  95 hltaNqaIleavege..ervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg...skeeleetgerLakfAeelgvpfefnvl 181
                       + +aN+ +lea+e +  + +H++D+++s+G+QWp++++aLa R++gpp  l++T +++            +   + L++fA++l++++e nv 
  PSME_00012118-RA 237 YTIANRSLLEAFEDQtnKVLHVLDIGVSHGIQWPTFIEALARRQAGPPsLLKLTIIADTLGApfsAGPPSNDFPNCLKRFAKSLNLDMEVNV- 328
                       *************9985667************************8888679*******554488888999*********************9. PP

              GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrll..........desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyy 264
                       +a+ l++l+ e+L vk++Eala++ +++lh+ll          d+++++  +rd+++k++k+l+P ++ ++++++dh+s++F+erf +++++ 
  PSME_00012118-RA 329 IAQPLDSLTREALGVKEDEALAICAQFRLHQLLekgldknegkDNQLTSVPPRDKFIKFIKDLNPLLFLLSDNDIDHSSPDFVERFKNSVDHL 421
                       7********************************9999999987667777779***************************************** PP

              GRAS 265 salfdsleaklpres.eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesg 356
                       + +++s+++ +   + +er+ vE e  + ++vn va  ga+r+er+e+  +W++r++e GF     s+k+ + a+++lrk++s+ +++  e+g
  PSME_00012118-RA 422 WRFLESTSVCFKGREcDERRLVEGE-AAMALVNNVAYDGASRVERNESHLNWSNRVREGGFVCEIPSDKVIDCARAMLRKHDSN-WEMRLEDG 512
                       *******988876666*********.9999****************************************************66.899999** PP

              GRAS 357 slvlgWkdrpLvsvSaWr 374
                       ++ l+Wk++p++++S W+
  PSME_00012118-RA 513 CISLCWKNNPVTFCSLWK 530
                       *****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.312121511IPR005202Transcription factor GRAS
PfamPF035141.6E-76148530IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MAEGEECNGG YGSLLDWLDI GDESSSMDPF INGPIAEQDH EDFWEAALPA MDIHPETQFV  60
MEPSFSSNDS VAPTAHRGDA DSESFWAEPP VSDSQLDLEA AGNNSNNNNN SSNSNSNSNS  120
NSNSNNKGRS GGRQSSPPNL PKESRWAEQL LNPCAIAIAN NNIVRIQHLI WVLHDLASVS  180
GDANHRLAAH GLRAFTAKIM HAGGTLPCSD FISADPKLFH KALLKFHEVS PWYQLLYTIA  240
NRSLLEAFED QTNKVLHVLD IGVSHGIQWP TFIEALARRQ AGPPSLLKLT IIADTLGAPF  300
SAGPPSNDFP NCLKRFAKSL NLDMEVNVIA QPLDSLTREA LGVKEDEALA ICAQFRLHQL  360
LEKGLDKNEG KDNQLTSVPP RDKFIKFIKD LNPLLFLLSD NDIDHSSPDF VERFKNSVDH  420
LWRFLESTSV CFKGRECDER RLVEGEAAMA LVNNVAYDGA SRVERNESHL NWSNRVREGG  480
FVCEIPSDKV IDCARAMLRK HDSNWEMRLE DGCISLCWKN NPVTFCSLWK SCLNEPT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-2717753033375GRAS family transcription factor containing p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2442901e-140KP244290.2 Pinus radiata SCL5 (SCL5) mRNA, partial cds.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.13e-92GRAS family protein